.
The Open Protein Structure Annotation Network
PDB Keyword
.

2iak

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural analysis of the plakin domain of bullous pemphigoid antigen1 (BPAG1) suggests that plakins are members of the spectrin superfamily. J.Mol.Biol. 366 244-257 2007
    Site NYSGXRC
    PDB Id 2iak Target Id NYSGXRC-9443a
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS7844,NP_598594, PF00435 Molecular Weight 615182.67 Da.
    Residues 5379 Isoelectric Point 5.51
    Sequence magylspaaymyveeqeylqayedvlerykderdkvqkktftkwinqhlmkvrkhvndlyedlrdghnl isllevlsgdtlprekgrmrfhrlqnvqialdylkrrqvklvnirndditdgnpkltlgliwtiilhfq isdihvtgesedmsakerlllwtqqategyagvrcenfttcwrdgklfnaiihkyrpdlidmntvavqs nlanlehafyvaekigvirlldpedvdvsspdeksvityvsslydafpkvpeggegigandvevkwiey qnmvnyliqwirhhvvtmsertfpnnplelkalynqylqfkekeippkemekskikrlyklleiwiefg rikllqgyhpndiekewgkliiamlerekalrpeverldmlqqiatrvqrdsvscedklilarnalqsd skrlesgvqfqneaeiagyilecenllrqhvidvqilidgkyyqadqlvqrvaklrdeimalrnecssv yskgrmltteqtklmisgitqslnsgfaqtlhpslnsgltqsltpsltsssvtsglssgmtsrltpsvt pvyapgfpsvvapnfslgvepnslqtlklmqirkpllksslldqnlteeevnmkfvqdllnwvdemqvq ldrtewgsdlpsveshlenhknvhraieefesslkeakiseiqmtaplklsytdklhrlesqyakllnt srnqerhldtlhnfvtratneliwlnekeesevaydwsernssvarkksyhaelmreleqkeesikavq eiaeqlllenhparltieayraamqtqwswilqlcqcveqhiqensayfeffndakeatdylrnlkdai qrkyscdrsssihkledlvqesmekeellqyrsvvaglmgraktvvqlkprnpdnplktsipikaicdy rqieitiykddecvlannshrakwkvisptgneamvpsvcftvpppnkeavdfanrieqqyqsvltlwh eshinmksvvswhylvneidrirasnvasiktmlpgehqqvlsnlqsrledfledsqesqifsgsdisq lekevsvcrkyyqellksaereeqeesvynlyisevrnirlrlescedrlirqirtplerddlhesmlr iteqeklkkeldrlkddlgtitnkceeffsqaadspsvpalrselsvviqslsqiysmsstyieklktv nlvlkntqaaealvklyetklceeeaviadknnienlmstlkqwrsevdekrevfhaledelqkakais demfkthkerdldfdwhkekadqlverwqsvhvqidnrlrdlegigkslkhyrdsyhplddwiqhiett qrkiqenqpenskalalqlnqqkmlvseievkqskmdecqkyseqysaavkdyelqtmtyramvesqqk spvkrrriqssadlviqefmdlrtrytalvtlmtqyikfagdslkrleeeeksldeekkqhiekakelq kwvsnisktlgdgekagkplfskqqmsskeistkkeqfsealqttqiflakhgdklteeersdlekqvk tlqegynllfseslkqqelqpsgeskvpekvvaerqqeyreklqglcdlltqtenrlisnqeafvigdg tvelqkyqskqeelqrdmqgstqameeivrntelflkesgdelsqadralieqklnevkmkcaqlnlka eqsrkeldkavttalkeetekvaavrqleesktkienllnwlsnveedsegvwtkhtqpmeqngtylhe gdsklgageedevngnlletdaeghseatkgnlnqqyekvkaqhgkimaqhqavllatqsaqvllekqg hylspeekeklqkntqelkvhyekvlaecekkvklthslqeelekfdtdysefehwlqqseqelanlea gaddlsglmdkltrqksfsedvishkgdlryitisgnrvidaakscskrdsdrigkdsvetsathrevq tkldqvtdrfrslyskcsvlgnnlkdlvdqyqqyedascgllsglqaceakaskhlrepialdpknlqr qleetkalqgqissqqvaveklkktaevlldakgsllpakndiqktlddivgryddlskcvnerneklq itltrslsvqdaldemldwmgsvesslvkpgqvplnstalqdliskdtmleqditgrqssinamnekvk tfiettdpstasslqakmkdlsarfseasqkhkeklakmvelkakveqfeklsdklqtfletqsqalte vampgkdvpelsqhmqestakflehrkdlealhsllkeisshglpgdkalvfektnnlsrkfkemedti qekkdalsscqeqlsafqtlaqslktwikettkqvpvvkpslgtedlrksleetkklqekwnlkapeih kannsgvslcnllsalispakaiaaaksggvilngegtdtntqdflankgltsikkdmtdishsyedlg lllkdkivelntklsklqkaqeessammqwlekmnktasrwrqtptpadtesvklqveqnksfeaelkq nvnkvqelkdklselleenpeapeaqswkqalaemdtkwqelnqltmdrqqkleessnnltqfqtteaq lkqwlmekelmvsvlgplsidpnmlntqkqqvqillqefdtrkpqyeqltaagqgilsrpgedpslhgi vneqleavtqkwdnltgqlrdrcdwidqaivkstqyqsllrslsgtltelddklssgltsgalpdavnq qleaaqrlkqeieqqapkikeaqevcedlsalvkeeylkaelsrqlegilksfkdieqktenhvqhlqs acasshqfqqmskdfqawldakkeeqrdsppisakldvlesllnsqkdfgktfteqsniyektisegen lllktqgaekaalqlqlntmktdwdrfrkqvkereeklkdslekalkyreqvetlrpwidrcqhsldgv tfsldptesessiaelkslqkemdhhfgmlellnntansllsvcevdkeavteenqslmekvnrvteql qsktvslenmaqkfkefqevsrdtqrqlqdtkeqlevhhslgpqaysnkhlsvlqaqqkslqtlkqqvd eakrlaqdlvveaadskgtsdvllqaetlaeehselsqqvdekcsfletklqglghfqntiremfsqft ecddeldgmapvgrdaetlrkqkacmqtflkklealmasndsanrtckmmlateetspdligvkrdlea lskqcnklldraktreeqvdgatekleefhrkleefstllqkaeeheesqgpvgtetetinqqldvfkv fqkeeieplqvkqqdvnwlgqgliqsaaantctqglehdldsvnsrwktlnkkvaqrtsqlqeallhcg rfqdalesllswmadteelvanqkppsaefkvvkaqiqeqkllqrlledrkstvevikregekiaasae padrvkltrqlslldsrweallsraearnrqlegisvvaqefhetleplnewltavekklansepigtq apkleeqisqhkalqedillrkqsvdqallnglellkqttgdevliiqdkleaikarykditklsadva ktlehalqlagqlqsmhkelcnwldkvevellsyetqglkgeaasqvqerqkelknevrsnkalvdsln evssallelvpwrareglektiaedneryrlvsdtitqkveeidaailrsqqfeqaadaelswitetqk klmslgdirleqdqtsaqlqvqkaftmdilrhkdiidelvtsghkimttsseeekqsmkkkldkvlkky davcqinserhlqleraqslvsqfwetyeelwpwltetqriisqlpapaleyetlrrqqeehrqlreli aehkphidkmnktgpqllelspkegiyiqekyvaadtlysqikedvkkravvldeaisqstqfhdkidq ilesleriaerlrqppsisaevekikeqigenksvsvdmeklqplyetlrqrgeemiarsegtekdvsa ravqdkldqmvfiwgsihtlveereaklldvmelaekfwcdhmslvvtikdtqdfirdledpgidpsvv kqqqeaaeaireeidglqeeldmvitlgseliaacgepdkpivkksidelnsawdslnkawkdrvdrle eamqaavqyqdglqgifdwvdiagnklatmspigtdletvkqqieelkqfkseayqqqiemerlnhqae lllkkvteeadkhtvqdplmelkliwdslderivsrqhklegallalgqfqhaldellawlthtkglls eqkpvggdpkaieielakhhvlqndvlahqstveavnkagndliessegeeasnlqyklrilnqrwqdi lektdqrkqqldsalrqakgfhgeiedlqqwltdterhllaskplgglpetakeqlnahmevctafaik eetykslmlrgqqmlarcprsaetnidqditnlkekwesvksklnekktkleealhlamnfhnslqdfi nwltqaeqtlnvasrpslildtilfqidehkvfanevnshreqiieldktgthlkyfsqkqdvvliknl lisvqsrwekvvqrlvergrsldearkrakqfheawsklmewleeseksldseleiandpdkikaqlvq hkefqkslggkhsvydttnrtgrslkektsladdnlkldnmlselrdkwdticgksverqnkleeallf sgqftdalqalidwlyrvepqlaedqpvhgdidlvmnlidnhkvfqkelgkrtssvqalkrsarelieg srddsswvrvqmqelstrwetvcalsiskqtrlesalqqaeefhsvvhtllewlaeaeqtlrfhgalpd dedalrtlieqhkefmkrleekraelskatgmgdallavchpdsittikhwitiiqarfeevlawakqh qqrlagalagliakqelletllawlqwaettltekdkevipqeieevktliaehqtfmeemtrkqpdvd kvtktykrratdppslqshipvldkgragrkrfpasgfypsgsqtqietknprvnllvskwqqvwllal errrklndaldrleelrefanfdfdiwrkkymrwmnhkksrvmdffrridkdqdgkitrqefidgilss kfptsrlemsavadifdrdgdgyidyyefvaalhpnkdaykpitdadkiedevtrqvakckcakrfqve qigdnkyrfflgnqfgdsqqlrlvrilrstvmvrvgggwmaldeflvkndpcrvhhhgskmlrsesnss itatqptlakgrtnmelrekfiladgasqgmaafrprgrrsrpssrgaspnrstsasshacqaasppvp aaastpkgtpiqgsklrlpgylsgkgfhsgedsalittaaarvrtqfaesrktpsrpgsragskagsrassrrgsdasdfdiseiqsvcsdvetvpqthrpvpragsrpstakpskiptpqrrspaskldksskr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 3.00 Rfree 0.26655
    Matthews' coefficent Rfactor 0.2263
    Waters 10 Solvent Content

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 2iak
    1. The structure and binding behavior of the bacterial cell surface layer protein SbsC
    T Pavkov, EM Egelseer, M Tesarz, DI Svergun - Structure, 2008 - Elsevier
     
    2. Structural analysis of the plakin domain of bullous pemphigoid antigen1 (BPAG1) suggests that plakins are members of the spectrin superfamily
    JJ Jefferson, C Ciatto, L Shapiro, RKH Liem - Journal of molecular biology, 2007 - Elsevier
     
    3. The structure of the ankyrin-binding site of _-spectrin reveals how tandem spectrin-repeats generate unique ligand-binding properties
    PR Stabach, I Simonovi_, MA Ranieri - , 2009 - bloodjournal.hematologylibrary.org
     
    4. The structure of a tandem pair of spectrin repeats of plectin reveals a modular organization of the plakin domain
    A Sonnenberg, AM Rojas, JM de Pereda - Journal of molecular biology, 2007 - Elsevier
     
    5. Crystal structure of a rigid four spectrin repeat fragment of the human desmoplakin plakin domain
    HJ Choi, WI Weis - Journal of Molecular Biology, 2011 - Elsevier
     
    6. The structure of the plakin domain of plectin reveals a non-canonical SH3 domain interacting with its fourth spectrin repeat
    E Ortega, RM Buey, A Sonnenberg - Journal of Biological , 2011 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch