.
The Open Protein Structure Annotation Network
PDB Keyword
.

2iec

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of uncharacterized conserved archael protein from Methanopyrus kandleri.
    Site NYSGXRC
    PDB Id 2iec Target Id NYSGXRC-10163b
    Molecular Characteristics
    Source Methanopyrus kandleri
    Alias Ids TPS7984,Q8TX89, PF04038 Molecular Weight 13715.83 Da.
    Residues 121 Isoelectric Point 4.77
    Sequence lkyfkrlsdreraifeagitlgaiyhqfcgtpvspgtaeevakcieraallqpcvidarvevdvssedtd nyggytevsgrnlrvtivtrcgeweavgklefieelnyplmwveeirrveq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.33 Rfree 0.2955
    Matthews' coefficent 2.04 Rfactor 0.2019
    Waters 215 Solvent Content 39.68

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 2iec
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    2. Comparative genomics guided discovery of two missing archaeal enzyme families involved in the biosynthesis of the pterin moiety of methanopterin and
    V De Crecy-Lagard, G Phillips - ACS Chemical , 2012 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch