.
The Open Protein Structure Annotation Network
PDB Keyword
.

2if6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hypothetical metalloprotein yiiX from Escherichia coli O157:H7. To be Published
    Site NYSGXRC
    PDB Id 2if6 Target Id NYSGXRC-10166a
    Molecular Characteristics
    Source Escherichia coli o157:h7
    Alias Ids TPS7986,Q8X778, PF06520 Molecular Weight 23153.65 Da.
    Residues 202 Isoelectric Point 9.56
    Sequence mkirllilsllvsvpafawqpqtgdiifqisrssqskaiqlathsdyshtgmlvmrnkkpyvfeavgpv kytplkqwiahgekgkyvvrrvegglsveqqqklaqtakrylgkpydfsfswsddrqycsevvwkvyqn algmrvgeqqklkefdlsnplvqaklkerygknipleetvvspqavfdapqlttvakewplfsw
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.23103
    Matthews' coefficent 2.80 Rfactor 0.17861
    Waters 440 Solvent Content 56.13

    Ligand Information
    Ligands UNX (UNKNOWN) x 2
    Metals

    Jmol

     
    Google Scholar output for 2if6
    1. A conserved poxvirus NlpC/P60 superfamily protein contributes to vaccinia virus virulence in mice but not to replication in cell culture
    TG Senkevich, LS Wyatt, AS Weisberg, EV Koonin - Virology, 2008 - Elsevier
     
    2. The Rho GTPase inactivation domain in Vibrio cholerae MARTX toxin has a circularly permuted papain_like thiol protease fold
    J Pei, NV Grishin - Proteins: Structure, Function, and , 2009 - Wiley Online Library
     
    3. Structural Analysis of Papain-Like NlpC/P60 Superfamily Enzymes with a Circularly Permuted Topology Reveals Potential Lipid Binding Sites
    Q Xu, ND Rawlings, HJ Chiu, L Jaroszewski, HE Klock - PloS one, 2011 - dx.plos.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch