.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ij9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Uridylate Kinase from Archaeoglobus Fulgidus. To be Published
    Site NYSGXRC
    PDB Id 2ij9 Target Id NYSGXRC-6297b
    Molecular Characteristics
    Source Archaeoglobus fulgidus
    Alias Ids TPS7757,NP_070866.1, PF00696 Molecular Weight 23396.82 Da.
    Residues 219 Isoelectric Point 8.54
    Sequence mkvvlslggsvlsnesekirefaktiesvaqqnqvfvvvgggklareyikrarelgasetfcdyigiaa trlnamllisaipsaakkvpvdfmeaeelsklyrvvvmggtfpghttdataallaefikadvfinatnv dgvysadpksdtsavkydrlspqqlveivsrssakagtnvvidllaakiierskiktyvilgtpenimk avkgeavgtvia
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.90 Rfree 0.33021
    Matthews' coefficent 4.32 Rfactor 0.2828
    Waters Solvent Content 71.55

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 2ij9
    1. The Crystal Structure of UMP Kinase from Bacillus anthracis(BA1797) Reveals an Allosteric Nucleotide-Binding Site
    C Meier, LG Carter, S Sainsbury, EJ Mancini - Journal of molecular , 2008 - Elsevier
     
    2. Unique GTP-binding pocket and allostery of uridylate kinase from a gram-negative phytopathogenic bacterium
    JL Tu, KH Chin, AHJ Wang, SH Chou - Journal of molecular biology, 2009 - Elsevier
     
    3. Structural and functional studies of enzymes in nucleotide metabolism
    L Egeblad - 2011 - pub.epsilon.slu.se
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch