.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ijq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the hypothetical Protein from Haloarcula marismortui. To be Published
    Site NYSGXRC
    PDB Id 2ijq Target Id NYSGXRC-10060g
    Molecular Characteristics
    Source Haloarcula marismortui
    Alias Ids TPS7943,PF03745, Q5V3A0 Molecular Weight 18474.16 Da.
    Residues 160 Isoelectric Point 4.80
    Sequence mddhtrdptvkapdgnpsgwrtdgqwehetlrravvhgvrlynsgefheshdcfedewynygrgntesk flhgmvqvaagaykhfdfedddgmrslfrtslqyfrgvpndyygvdlldvrttvtnalsdpsalhgwqi rldgeyptcrpediefaesleh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.88 Rfree 0.25559
    Matthews' coefficent 2.84 Rfactor 0.19698
    Waters 271 Solvent Content 56.63

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ijq
    1. Characterization of metalloproteins by high-throughput X-ray absorption spectroscopy
    W Shi, M Punta, J Bohon, JM Sauder, R D'Mello - Genome , 2011 - gb.cw.com.tw
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch