.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ijr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a hypothetical protein from Yersinia pseudotuberculosis. To be Published
    Site NYSGXRC
    PDB Id 2ijr Target Id NYSGXRC-10282b
    Molecular Characteristics
    Source Yersinia pseudotuberculosis
    Alias Ids TPS8012,Q6EVP2, PF06924 Molecular Weight 33948.88 Da.
    Residues 301 Isoelectric Point 5.08
    Sequence mfewcknrleitgrsvfvdimqqwvtgeevplyrhaiqqsirlflagcagilkpvkcmeyppfprlvsh gtgsavasnlafqhwldlllkdavldgdtirqidriylqsgiasvkwetipegarqiitqlmarqypdw fgvaswsshingadcwtklgvmqehacncdmlmiiptrlaielngnsqlltgvstthdlyshlygmawp sgqniiwqrdrinslrldfdspsyppsaelmgelsavfdceirhwyqepvngirgydcydrgdhvdsge ygagpflpplkveevtvngqeeaav
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.70 Rfree 0.27917
    Matthews' coefficent 3.14 Rfactor 0.22476
    Waters 44 Solvent Content 60.78

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch