.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ijz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structrue of putative aminopeptidase 2 from Pseudomonas Aeruginosa. To be Published
    Site NYSGXRC
    PDB Id 2ijz Target Id NYSGXRC-6224a
    Molecular Characteristics
    Source Pseudomonas aeruginosa
    Alias Ids TPS7754,PF02127, NP_251937.1 Molecular Weight 46655.88 Da.
    Residues 429 Isoelectric Point 5.65
    Sequence mraelnqglidflkasptpfhataslarrleaagyrrlderdawhtetggryyvtrndssliairlgrr splesgfrlvgahtdspclrvkpnpeiarngflqlgvevyggalfapwfdrdlslagrvtfrangkles rlvdfrkaiavipnlaihlnraanegwpinaqnelppiiaqlapgeaadfrllldeqllrehgitadvv ldyelsfydtqsaavvglndefiagarldnllschagleallnaegdencilvctdheevgscshcgad gpfleqvlrrllpegdafsraiqrsllvsadnahgvhpnyadrhdanhgpalnggpvikinsnqryatn setagffrhlcqdsevpvqsfvtrsdmgcgstigpitasqvgvrtvdiglptfamhsirelagshdlah lvkvlgafyasselp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 12
    Resolution (Å) 3.00 Rfree 0.291
    Matthews' coefficent 3.09 Rfactor 0.255
    Waters 3177 Solvent Content 60.19

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ijz
    1. Structure of human aspartyl aminopeptidase complexed with substrate analogue: insight into catalytic mechanism, substrate specificity and M18 peptidase
    A Chaikuad, ES Pilka, A De Riso - BMC Structural , 2012 - biomedcentral.com
     
    2. X-ray crystal structure and specificity of the Plasmodium falciparum malaria aminopeptidase Pf M18AAP
    KK Sivaraman, CA Oellig, K Huynh, SC Atkinson - Journal of Molecular , 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch