.
The Open Protein Structure Annotation Network
PDB Keyword
.

2im9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hypothetical protein from Legionella pneumophila subsp. pneumophila str. Philadelphia 1. TO BE PUBLISHED
    Site NYSGXRC
    PDB Id 2im9 Target Id NYSGXRC-10224b
    Molecular Characteristics
    Source Legionella pneumophila
    Alias Ids TPS8002,Q5WYX8, PF07313 Molecular Weight 40914.33 Da.
    Residues 356 Isoelectric Point 9.35
    Sequence mkhtynpfryliyfaffitslssyssqttnikeqtdtglapptplittnsaaieeqanssirklyhtln tmpntsmadrinqisayfkgtkyilgslgegpnarydqfpryrvdgfdcdtyvntvlslalanslesfq eclkhtrykngkrsyinrnhftsidwnnynqkrgllkditfsirnekkqpvalyanalinkpqwynhkt idtirlqkqdkneqekrlvelktkgktletslsnvpyipftalfsenkpnlhlfsqipngavieiirpn wdlrqqigteldishlgfaiwinnelffrqassqygkvvdvslidyldkarssptikginiqvvlpekp vsngcqlfdir
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.67 Rfree 0.21156
    Matthews' coefficent 1.92 Rfactor 0.17151
    Waters 271 Solvent Content 35.90

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2im9
    1. Structural Basis of Murein Peptide Specificity of a [gamma]-D-Glutamyl-L-Diamino Acid Endopeptidase
    Q Xu, S Sudek, D McMullan, MD Miller, B Geierstanger - Structure, 2009 - Elsevier
     
    2. Structure of the-D-glutamyl-L-diamino acid endopeptidase YkfC from Bacillus cereus in complex with L-Ala--D-Glu: insights into substrate recognition by NlpC/P60
    Q Xu, P Abdubek, T Astakhova, HL Axelrod - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch