.
The Open Protein Structure Annotation Network
PDB Keyword
.

2img

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of human dual specificity protein phosphatase 23, VHZ, enzyme-substrate/product complex. J.Biol.Chem. 283 8946-8953 2008
    Site NYSGXRC
    PDB Id 2img Target Id NYSGXRC-8673a
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS7913,NP_060293, PF00782 Molecular Weight 16587.24 Da.
    Residues 150 Isoelectric Point 8.44
    Sequence mgvqppnfswvlpgrlaglalprlpahyqflldlgvrhlvsltergpphsdscpgltlhrlripdfcpp apdqidrfvqivdeanargeavgvhcalgfgrtgtmlacylvkerglaagdaiaeirrlrpgsietyeq ekavfqfyqrtk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.93 Rfree 0.229
    Matthews' coefficent 2.05 Rfactor 0.195
    Waters 114 Solvent Content 40.00

    Ligand Information
    Ligands MLT (MALATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2img
    1. Structural genomics of protein phosphatases
    SC Almo, JB Bonanno, JM Sauder, S Emtage - Journal of structural and , 2007 - Springer
     
    2. S-nitrosylation of Drp1 links excessive mitochondrial fission to neuronal injury in neurodegeneration
    T Nakamura, P Cieplak, DH Cho, A Godzik, SA Lipton - Mitochondrion, 2010 - Elsevier
     
    3. Structure of human dual specificity protein phosphatase 23, VHZ, enzyme-substrate/product complex
    R Agarwal, SK Burley, S Swaminathan - Journal of Biological Chemistry, 2008 - ASBMB
     
    4. Crystal Structure of the Cytoplasmic Phosphatase and Tensin Homolog (PTEN)-like Region of Ciona intestinalis Voltage-sensing Phosphatase Provides Insight into
    M Matsuda, K Takeshita, T Kurokawa, S Sakata - Journal of Biological , 2011 - ASBMB
     
    5. Dimerization of vaccinia virus VH1 is essential for dephosphorylation of STAT1 at tyrosine 701
    AC Koksal, G Cingolani - Journal of Biological Chemistry, 2011 - ASBMB
     
    6. Avirulence proteins AvrBs7 from Xanthomonas gardneri and AvrBs1. 1 from Xanthomonas euvesicatoria contribute to a novel gene-for-gene interaction in pepper
    N Potnis, GV Minsavage, JK Smith - Molecular Plant- , 2011 - Am Phytopath Society
     

    Protein Summary



    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch