.
The Open Protein Structure Annotation Network
PDB Keyword
.

2imh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hypothetical protein from Silicibacter pomeroyi. To be Published
    Site NYSGXRC
    PDB Id 2imh Target Id NYSGXRC-10119g
    Molecular Characteristics
    Source Silicibacter pomeroyi
    Alias Ids TPS7974,Q5LQD5, PF06267 Molecular Weight 23167.50 Da.
    Residues 221 Isoelectric Point 4.69
    Sequence mtfsilahdpetgaiggaaatgslcvggwvlrgdlnagmsasqgaapstfwgeevlqhlrdgshpedav nhvtsqdsgrayrqlaamdllgnaaaftgsenqdikgsvtfasgiasgnmlgdnsvlgamteafvasdl tferrllaaliaaegagsdfrgllsaamlvlhpdrppvtlridyhpdnpigaleqlyqkattgdyadwa rqvpvlsdkerild
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.57 Rfree 0.2066
    Matthews' coefficent 2.25 Rfactor 0.17076
    Waters 550 Solvent Content 45.22

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch