.
The Open Protein Structure Annotation Network
PDB Keyword
.

2iml

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a hypothetical protein from Archaeoglobus fulgidus binding riboflavin 5'-phosphate. To be Published
    Site NYSGXRC
    PDB Id 2iml Target Id NYSGXRC-10069c
    Molecular Characteristics
    Source Archaeoglobus fulgidus
    Alias Ids TPS7944,PF04289, O28442 Molecular Weight 21277.01 Da.
    Residues 189 Isoelectric Point 6.00
    Sequence mrladfgftdgineiiaitenedgswnaapigiivedsssdtakaklyrnrtranlersgvlfanvtdd alvfavssfgnlnddwyaspnppiikgamawcrfeaemrsgvahlkltdgeiiekrvrainrglsavie alvhatryvaiksderrkellerihyyreivqkcgserekrafeiimekig
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.65 Rfree 0.19677
    Matthews' coefficent 2.81 Rfactor 0.16882
    Waters 819 Solvent Content 56.25

    Ligand Information
    Ligands FMN (FLAVIN) x 2;GOL (GLYCEROL) x 8
    Metals

    Jmol

     
    Google Scholar output for 2iml
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch