.
The Open Protein Structure Annotation Network
PDB Keyword
.

2imr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a hypothetical protein DR_0824 from Deinococcus radiodurans. To be Published
    Site NYSGXRC
    PDB Id 2imr Target Id NYSGXRC-9256a
    Molecular Characteristics
    Source Deinococcus radiodurans
    Alias Ids TPS7787,PF01979, 15805850 Molecular Weight 45503.21 Da.
    Residues 418 Isoelectric Point 5.94
    Sequence lrfsavsrhhrgasidpmtfseattpdaltpdahtprlltcdvlytgmggaqspggvvvvgetvaaagh pdelrrqyphaaeeragaviapppvnahthldmsayefqalpyfqwipevvirgrhlrgvaaaqagadt ltrlgaggvgdivwapevmdallaredlsgtlyfevlnpfpdkadevfaaarthlerwrrlerpglrlg lsphtpftvshrlmrllsdyaageglplqihvaehptelemfrtgggplwdnrmpalyphtlaevigre pgpdltpvryldelgvlaarptlvhmvnvtpddiarvaragcavvtcprsnhhlecgtfdwpafaaagv evalgtdsvasgetlnvreevtfarqlypgldprvlvraavkggqrvvggrtpflrrgetwqegfrwelsrdl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.78 Rfree 0.23
    Matthews' coefficent 2.06 Rfactor 0.201
    Waters 170 Solvent Content 40.24

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 2imr
    1. Target selection and annotation for the structural genomics of the amidohydrolase and enolase superfamilies
    U Pieper, R Chiang, JJ Seffernick, SD Brown - Journal of structural and , 2009 - Springer
     
    2. Characterization of metalloproteins by high-throughput X-ray absorption spectroscopy
    W Shi, M Punta, J Bohon, JM Sauder, R D'Mello - Genome , 2011 - gb.cw.com.tw
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch