.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ioj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a hypothetical protein (Y1212_ARCFU) from Archeoglobus fulgidus. To be Published
    Site NYSGXRC
    PDB Id 2ioj Target Id NYSGXRC-10007g
    Molecular Characteristics
    Source Archaeoglobus fulgidus
    Alias Ids TPS7932,O29056, PF07085 Molecular Weight 38213.35 Da.
    Residues 352 Isoelectric Point 5.12
    Sequence vmkcllvssvegysgksgiiialglklremgyevgyfkalgvntvkvgdraveedslitakilgveedv cpvvldrpyidfatsvdpvvlrkavldrftevsegkdvvivegsqnyrtgvavgiddasvakmlsakvl lvgkyvndfvvdevlaaksafgtmlekvvfnqvsgykmsyiegiarkvlneagldivgaiprnpvlagl sveeireavsgeyliepreekmveqvvigamspqsalrylrearnaalvtggdrsdllltalempnvrc liltgnlepvqlvltkaeergvpviltghdtltavsrlesvfgrtrirgepkvgimrelfeshvnvkti ieylgld
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.15 Rfree 0.268
    Matthews' coefficent 2.03 Rfactor 0.23
    Waters 70 Solvent Content 39.42

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ioj
    1. Crystal Structures of the CBS and DRTGG Domains of the Regulatory Region of Clostridium perfringens Pyrophosphatase Complexed with the Inhibitor
    H Tuominen, A Salminen, E Oksanen, J Jmsen - Journal of molecular , 2010 - Elsevier
     
    2. Structure-Based Approach for the Discovery of Novel Selective Estrogen Receptor Modulators
    C Rosano, E Stec-Martyna, R Lappano - Current medicinal , 2011 - ingentaconnect.com
     
    3. THE STruCTurAL BASiS For iNorGANiC PyroPHoSPHATASE CATALySiS AND rEGuLATioN
    H Tuominen - 2011 - doria.fi
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch