.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ipq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of C-terminal domain of Hypothetical protein STY4665. To be Published
    Site NYSGXRC
    PDB Id 2ipq Target Id NYSGXRC-10172b
    Molecular Characteristics
    Source Salmonella typhi
    Alias Ids TPS7990,Q8Z1C5, PF07515 Molecular Weight 58513.26 Da.
    Residues 529 Isoelectric Point 5.32
    Sequence mfrkvkswmekknfrqieenksgnakkrlipctdgyfnpaaisdllqherrqqwlrilwensalpkerf eryfllplhgvvglcqrlpasaqgkfaytdgmvdyviqttvfavrlskgymlprgasaeeqsaqsvsws avvyyaalfhslgrlwniegelrsgavwrpglsvpeepyrfrfkaepdiagaqvygelialrflpepvl qwlgknpdilrtllafisgrysdamditdivneaivhaggiplgfpiaqeeqtselaeilnpaatvapv lrkgssttppdvpvmvdggqettvllssldsdakpergegqptaetdpdvlqvmsilggltntdtqspe kegvntetdmvagesfpevavaletsaaeevindtvttectgsssggisslsstelgdlfwswlrdglr egdipvntadacvhltcgfvfisvpgvfflflkshsrscssglkesgrkeqvqaafekmrkhrvsdsrr fwqcclyeepggrgrykkltgylikmseiyangnfpddslflkvin
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.27
    Matthews' coefficent 2.15 Rfactor 0.203
    Waters 33 Solvent Content 42.81

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ipq
    1. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch