.
The Open Protein Structure Annotation Network
PDB Keyword
.

2iq1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural genomics of protein phosphatases. J.STRUCT.FUNCT.GENOM. 8 121-140 2007
    Site NYSGXRC
    PDB Id 2iq1 Target Id NYSGXRC-8700a
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS7915,PF00481, NP_689755 Molecular Weight 40995.11 Da.
    Residues 372 Isoelectric Point 6.27
    Sequence mstaalitlvrsggnqvrrrvllssrllqddrrvtptchsstseprcsrfdpdgsgspatwdnfgiwdn ridepillppsikygkpipkislenvgcasqigkrkenedrfdfaqltdevlyfavydghggpaaadfc hthmekcimdllpkeknletlltlafleidkafssharlsadatlltsgttatvallrdgielvvasvg dsrailcrkgkpmkltidhtperkdekerikkcggfvawnslgqphvngrlamtrsigdldlktsgvia epetkriklhhaddsflvlttdginfmvnsqeicdfvnqchdpneaahavteqaiqygtednstavvvp fgawgkyknseinfsfsrsfassgrwa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.25 Rfree 0.239
    Matthews' coefficent 2.64 Rfactor 0.181
    Waters 126 Solvent Content 53.46

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 2iq1
    1. Structural genomics of protein phosphatases
    SC Almo, JB Bonanno, JM Sauder, S Emtage - Journal of structural and , 2007 - Springer
     
    2. Crystal structure of pyruvate dehydrogenase phosphatase 1 and its functional implications
    DG Vassylyev, J Symersky - Journal of molecular biology, 2007 - Elsevier
     
    3. Characterization of the active site and a unique uncompetitive inhibitor of the PPM1-type protein Phosphatase PPM1D
    Y Chuman, H Yagi, T Fukuda, T Nomura - Protein and peptide , 2008 - ingentaconnect.com
     
    4. Structural Characterization of the Multidomain Regulatory Protein Rv1364c from Mycobacterium tuberculosis
    J King-Scott, PV Konarev, S Panjikar, R Jordanova - Structure, 2011 - Elsevier
     
    5. Structural and biochemical characterization of human mitochondrial branched-chain _-ketoacid dehydrogenase phosphatase
    RM Wynn, J Li, CA Brautigam, JL Chuang - Journal of Biological , 2012 - ASBMB
     
    6. Optimization of a cyclic peptide inhibitor of Ser/Thr phosphatase PPM1D (Wip1)
    R Hayashi, K Tanoue, SR Durell, DK Chatterjee - Biochemistry, 2011 - ACS Publications
     

    Protein Summary



    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch