.
The Open Protein Structure Annotation Network
PDB Keyword
.

2irm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural genomics of protein phosphatases. J.STRUCT.FUNCT.GENOM. 8 121-140 2007
    Site NYSGXRC
    PDB Id 2irm Target Id NYSGXRC-8880z
    Molecular Characteristics
    Source Anopheles gambiae
    Alias Ids TPS7925,PF00481, XP_311946 Molecular Weight 39652.67 Da.
    Residues 358 Isoelectric Point 5.46
    Sequence rtkswtddlkvcnqtgvgeainqiykddgrrcegyesrdkkclcisdnntslyailsghngvtvaenal qemaaelllgqlnvcntdeavkelirqsfmsvekgyfdsinphvatktaiqlhlsadgmnqyeisqqfe nvlqkldslnnalsvgssavlalihrshlylgnigncrallcktdehdtltvtqlsvdhnllnaeeaar lfrlglmaqnfegvplystrcignylgkagykdcnflssataepvifepeivggiqitpacrflvlmss glcralheifpgdastgnrelvrmiseefqnqstlggvaqsvvhrivqahhdtymqlveehrsvtfnsr ddvtllirnfnya
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 3.00 Rfree 0.27736
    Matthews' coefficent 3.76 Rfactor 0.21821
    Waters Solvent Content 67.26

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2irm
    1. Structural genomics of protein phosphatases
    SC Almo, JB Bonanno, JM Sauder, S Emtage - Journal of structural and , 2007 - Springer
     
    2. Resources for systems biology research
    JS Kim, H Yun, HU Kim, HS Choi, TY Kim - of microbiology and , 2006 - dspace.kaist.ac.kr
     
    3. Conformational analysis and design of cross_strand disulfides in antiparallel __sheets
    S Indu, V Kochat, S Thakurela - Proteins: Structure, , 2011 - Wiley Online Library
     

    Protein Summary

    2irm is the structure of the mosquito ortholog of human TAB1 (TAK1-binding protein). There is a structure in the PDB of human TAB1 by Conner et al (2j4o); it is 40% identical to mosquito TAB1. Two more recent structures of the human protein are in the PDB by Lu et al (2pom, 2pop).

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch