.
The Open Protein Structure Annotation Network
PDB Keyword
.

2isn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural genomics of protein phosphatases. J.STRUCT.FUNCT.GENOM. 8 121-140 2007
    Site NYSGXRC
    PDB Id 2isn Target Id NYSGXRC-8828z
    Molecular Characteristics
    Source Toxoplasma gondii
    Alias Ids TPS7924,ABV44288.1, PF00481 Molecular Weight 39647.87 Da.
    Residues 362 Isoelectric Point 5.46
    Sequence kkvitvnewytttvaatmlgrrptdedailvsapatsrpnvrikavfdghageatsqycakhaakhlgk lseftfaevkkaclsldaeiirklgpkhvagstgiivaierlsapvvenvvgreivpraheetfvplek liqeeeeaehpelvgryprvpdvqqktipagsflvtainigdsratlihsdggltrlskdhkpnhptea sriekaggsvetfdvprvdgvlalsrafgdsdfkmnpnlppeeqkviavpdvrqfyalssdllllacdg vyepsgmdwayvrdltvaemqrskgdleevaarvmdyaydmnsqdnisvmlvafhnqevehptavykvv sgqvdkvewdvagkkgn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.279
    Matthews' coefficent 2.24 Rfactor 0.241
    Waters 252 Solvent Content 44.97

    Ligand Information
    Ligands SO4 (SULFATE) x 3
    Metals PR (PRASEODYMIUM) x 2

    Jmol

     
    Google Scholar output for 2isn
    1. Structural genomics of protein phosphatases
    SC Almo, JB Bonanno, JM Sauder, S Emtage - Journal of structural and , 2007 - Springer
     
    2. Optimization of a cyclic peptide inhibitor of Ser/Thr phosphatase PPM1D (Wip1)
    R Hayashi, K Tanoue, SR Durell, DK Chatterjee - Biochemistry, 2011 - ACS Publications
     

    Protein Summary

    This is the full length sequence of PP2C2 from Toxoplasma gondii. The gene was codon-optimized and synthesized. Cloning, expression and protein purification was done at SGX Pharmaceuticals and crystallization was done by R. Agarwal in the lab of S. Swaminathan.

    NYSGXRC has completed the structures of three structures from Toxoplasma gondii, including PP2C2 (NYSGXRC-8828z) and PP2C-hn (NYSGXRC-9110a).


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch