.
The Open Protein Structure Annotation Network
PDB Keyword
.

2nly

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hypothetical protein BH1492 from Bacillus halodurans C-125. To be Published
    Site NYSGXRC
    PDB Id 2nly Target Id NYSGXRC-10097c
    Molecular Characteristics
    Source Bacillus halodurans
    Alias Ids TPS7961,PF04748, Q9KCS7 Molecular Weight 30032.99 Da.
    Residues 273 Isoelectric Point 5.86
    Sequence mqtyfklifllsasllclglaspddsnkgemkraaiiiddfggdvkgvddfltgeipvtvavmpflehs tkqaeiaqaaglevivhmplepkkgkiswlgpsgitsnlsvgevksrvrkafddipyavglnnhmgski venekimrailevvkeknafiidsgtsphslipqlaeelevpyatrsifldnthssrkeviknmrklak kakqgsepigighvgvrgdetyagirsmldefqaesiqlvpvsqllpspieedhnkfwqqpfqake
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.27314
    Matthews' coefficent 2.71 Rfactor 0.22195
    Waters 33 Solvent Content 54.58

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch