.
The Open Protein Structure Annotation Network
PDB Keyword
.

2nn4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a Hypothetical protein from B. subtilis, pfam:DUF910. To be Published
    Site NYSGXRC
    PDB Id 2nn4 Target Id NYSGXRC-10278a
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS8011,PF06014, P54494 Molecular Weight 8620.49 Da.
    Residues 71 Isoelectric Point 5.29
    Sequence mntfydvqqllktfghivyfgdreleiefmldelkelymnhmiekeqwaraaavlrkeleqtkngrdfy kg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.10 Rfree 0.28
    Matthews' coefficent 2.07 Rfactor 0.247
    Waters 47 Solvent Content 40.71

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2nn4
    1. Molecular replacement using ab initio polyalanine models generated with ROSETTA
    DJ Rigden, RM Keegan, MD Winn - Acta Crystallographica Section D , 2008 - scripts.iucr.org
     
    2. EDM-DEDM and protein crystal structure solution
    R Caliandro, B Carrozzini, GL Cascarano - Section D: Biological , 2009 - scripts.iucr.org
     
    3. Structure of YqgQ protein from Bacillus subtilis, a conserved hypothetical protein
    D Lakshminarasimhan, S Eswaramoorthy - Section F: Structural , 2009 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch