.
The Open Protein Structure Annotation Network
PDB Keyword
.

2npo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative transferase from Campylobacter jejuni subsp. jejuni NCTC 11168. To be Published
    Site NYSGXRC
    PDB Id 2npo Target Id NYSGXRC-3820d
    Molecular Characteristics
    Source Campylobacter jejuni
    Alias Ids TPS7748,NP_282271.1, PF00132 Molecular Weight 21146.60 Da.
    Residues 195 Isoelectric Point 8.45
    Sequence martekiyiygasghglvcedvaknmgykeciflddfkgmkfestlpkydffiaignneirkkiyqkis engfkivnlihksalispsaiveenagilimpyvvinakakiekgvilntssviehecvigefshvsvg akcagnvkigkncflginscvlpnlsladdsilgggatlvknqdekgvfvgvpakrm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.2513
    Matthews' coefficent 3.17 Rfactor 0.20618
    Waters 141 Solvent Content 61.16

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2npo
    1. Structure and active site residues of PglD, an N-acetyltransferase from the bacillosamine synthetic pathway required for N-glycan synthesis in Campylobacter jejuni
    ES Rangarajan, KM Ruane, T Sulea, DC Watson - Biochemistry, 2008 - ACS Publications
     
    2. Mutual information and variants for protein domain-domain contact prediction
    M Gomes, R Hamer, G Reinert - BMC Research , 2012 - biomedcentral.com
     
    3. The structural biology of enzymes involved in natural product glycosylation
    S Singh, GN Phillips Jr, JS Thorson - Natural Product Reports, 2012 - pubs.rsc.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch