.
The Open Protein Structure Annotation Network
PDB Keyword
.

2nq5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of methyltransferase from Streptococcus mutans. To be Published
    Site NYSGXRC
    PDB Id 2nq5 Target Id NYSGXRC-6426d
    Molecular Characteristics
    Source Streptococcus mutans
    Alias Ids TPS7761,NP_721282.1, PF01717 Molecular Weight 84136.51 Da.
    Residues 745 Isoelectric Point 5.48
    Sequence mtkvsslgyprlgenrewkklieaywagkvskndlfagakelrldflkkqlnagldlipvgdfslydhi ldlsvqfniipkrfakepididlyfaiargnkenvassmkkwfntnyhyivpewskqrpklnnnrlldl ylearevvgdkakpvitgpityvalstgvedftaavksllplykqvftelvkagasyiqvdepifvtde gkdylqaakavyayfakevpdakfifqtyfeglidsqvlsqlpvdafgldfvygleenleaiktgafkg keifagvidgrniwssdfvktsalletieeqsaaltiqpscsllhvpvttknetdldpvlrnglafade kltevkrlaehldgredpaydlhiahfdalqaadfrnvkledlsrvatkrpsdfakrrdiqqeklhlpl lptttigsfpqsreirrtrlawkrgdisdaeykqfiqaeierwiriqedldldvlvhgefervdmveff gqklagftttkfgwvqsygsravkppiiygdvqhlepitveetvyaqsltdrpvkgmltgpititnwsf ertdiprdqlfnqiglaikdeikllenagiaiiqvdeaalreglplrkskqkaylddavhafhiatssv kdetqihthmcyskfdeiidairaldadvisietsrshgdiiesfetavyplgiglgvydihsprvptk eevvanierplrqlsptqfwvnpdcglktrqepetiaalkvlvaatkevrqklgn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.258
    Matthews' coefficent 2.25 Rfactor 0.228
    Waters 348 Solvent Content 45.37

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2nq5
    1. Crystal structures of cobalamin-independent methionine synthase (MetE) from Streptococcus mutans: A dynamic zinc-inversion model
    TM Fu, J Almqvist, YH Liang, L Li, Y Huang - Journal of molecular , 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch