.
The Open Protein Structure Annotation Network
PDB Keyword
.

2nql

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Enolase from Agrobacterium Tumefaciens C58. To be Published
    Site NYSGXRC
    PDB Id 2nql Target Id NYSGXRC-9279a
    Molecular Characteristics
    Source Agrobacterium tumefaciens
    Alias Ids TPS7804,PF01188, 16119686 Molecular Weight 42310.87 Da.
    Residues 388 Isoelectric Point 5.30
    Sequence mnspiatvevftltqprkvpylgalregevvnpngyivrkgnrtvyptfdrsvlvrmtteagtvgwget ygivapgavaalindllagfvigrdasdpsavyddlydmmrvrgytggfyvdalaaldialwdiagqea gksirdllgggvdsfpayvsglpertlkargelakywqdrgfnafkfatpvaddgpaaeianlrqvlgp qakiaadmhwnqtperaleliaemqpfdpwfaeapvwtediaglekvskntdvpiavgeewrthwdmra riercriaivqpemghkgitnfirigalaaehgidviphatvgagiflaaslqasstlsmlkghefqhs ifepnrrlldgdmdcregryhlpsgpglgvrpseaalglieri
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.20144
    Matthews' coefficent 3.28 Rfactor 0.16937
    Waters 895 Solvent Content 62.50

    Ligand Information
    Ligands SO4 (SULFATE) x 11;UNL (UNKNOWN) x 2;GOL (GLYCEROL) x 6
    Metals NA (SODIUM) x 2

    Jmol

     
    Google Scholar output for 2nql
    1. Crystal structure of PG16 and chimeric dissection with somatically related PG9: structure-function analysis of two quaternary-specific antibodies that effectively
    M Pancera, JS McLellan, X Wu, J Zhu - Journal of , 2010 - Am Soc Microbiol
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch