.
The Open Protein Structure Annotation Network
PDB Keyword
.

2nr4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of conserved FMN bound hypothetical protein from Methanosarcina mazei. To be Published
    Site NYSGXRC
    PDB Id 2nr4 Target Id NYSGXRC-10069f
    Molecular Characteristics
    Source Methanosarcina mazei
    Alias Ids TPS7945,PF04289, Q8PVV4 Molecular Weight 23844.99 Da.
    Residues 212 Isoelectric Point 5.33
    Sequence ligflsdrqgfekqyhdidlssfgiregiseiiastgfehpnaapigivmkgerpfvrlfkgshtwenv lkekclasnvvydpilfvrstfsdlvpsefeyvdagefkfpvlkeaiawvvfecinlrntdqslvadlv plnagfnernikelpvpnrgfnavleatvhatryqltgeekylelirhyeslaskcggdaekkamkliy ealgl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.85 Rfree 0.256
    Matthews' coefficent 3.24 Rfactor 0.221
    Waters 227 Solvent Content 62.01

    Ligand Information
    Ligands FMN (FLAVIN) x 2
    Metals

    Jmol

     
    Google Scholar output for 2nr4
    1. Dveloppement d'une nouvelle mthode performante de classification des surfaces protiques d'interaction. Optimisations et extensions du logiciel MED-SuMo.
    O Doppelt-Azeroual - 2009 - hal-univ-diderot.archives-ouvertes.fr
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch