The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of conserved putative Baf family transcriptional activator from Campylobacter jejuni. To be Published
    Site NYSGXRC
    PDB Id 2nrh Target Id NYSGXRC-10117e
    Molecular Characteristics
    Source Campylobacter jejuni
    Alias Ids TPS7972,PF03309, Q5HW73 Molecular Weight 23921.29 Da.
    Residues 209 Isoelectric Point 6.51
    Sequence mllcdignsnanflddnkyftlsidqflefkneqkifyinvnehlkehlknqkkfinlepyflfdtiyq glgidriaacytiedgvvvdagsaitidiisnsihlggfilpgianykkiyshisprlksefntqvsld afpqktmdalsygvfkgiyllikdaaqnkklyftggdgqflanyfdhaiydkllifrgmkkiikenpnlly
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.291
    Matthews' coefficent 2.50 Rfactor 0.227
    Waters 86 Solvent Content 50.80

    Ligand Information
    Ligands SO4 (SULFATE) x 3



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch