.
The Open Protein Structure Annotation Network
PDB Keyword
.

2nrj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of the B component of Hemolysin BL from Bacillus cereus. Proteins 71 534-540 2008
    Site NYSGXRC
    PDB Id 2nrj Target Id NYSGXRC-10120c
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS7975,PF05791, P80172 Molecular Weight 41565.09 Da.
    Residues 375 Isoelectric Point 5.37
    Sequence mikkipykllavstlltittanvvspvatfaseieqtnngdtalsaneakmketlqkaglfaksmnays ymliknpdvnfegitingyvdlpgrivqdqknarahavtwdtkvkkqlldtltgiveydttfdnyyetm veaintgdgetlkegitdlrgeiqqnqkyaqqlieeltklrdsighdvrafgsnkellqsilknqgadv dadqkrleevlgsvnyykqlesdgfnvmkgailglpiiggiivgvardnlgklepllaelrqtvdykvt lnrvvgvaysnineidkalddainaltymstqwhdldsqysgvlghienaaqkadqnkfkflkpnlnaa kdswktlrtdavtlkegikelkvetvtpqk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.03 Rfree 0.257
    Matthews' coefficent 2.03 Rfactor 0.213
    Waters 199 Solvent Content 39.43

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2nrj
    1. Bacillus cereus Nhe is a pore-forming toxin with structural and functional properties similar to the ClyA (HlyE, SheA) family of haemolysins, able to induce osmotic lysis
    A Fagerlund, T Lindbck, AK Storset - , 2008 - Soc General Microbiol
     
    2. X_ray crystal structure of the B component of Hemolysin BL from Bacillus cereus
    M Madegowda, S Eswaramoorthy - Proteins: Structure, , 2008 - Wiley Online Library
     
    3. Production, secretion and biological activity of Bacillus cereus enterotoxins
    S Senesi, E Ghelardi - Toxins, 2010 - mdpi.com
     
    4. Monoclonal Antibodies Neutralize Bacillus cereus Nhe Enterotoxin by Inhibiting Ordered Binding of Its Three Exoprotein Components
    A Didier, R Dietrich, S Gruber, S Bock - Infection and , 2012 - Am Soc Microbiol
     
    5. Genomics of Bacillus Species
    OA kstad, AB Kolst - Genomics of Foodborne Bacterial Pathogens, 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch