.
The Open Protein Structure Annotation Network
PDB Keyword
.

2nv5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural genomics of protein phosphatases. J.STRUCT.FUNCT.GENOM. 8 121-140 2007
    Site NYSGXRC
    PDB Id 2nv5 Target Id NYSGXRC-8613c
    Molecular Characteristics
    Source Rattus norvegicus
    Alias Ids TPS7904,XP_233065, PF00102 Molecular Weight 200251.97 Da.
    Residues 1783 Isoelectric Point 6.06
    Sequence mgpqlkvvertrtatmlcaasgnpdpeitwfkdflpvdtsnnngrikqlrsesiggtpirgalqieqse esdqgkyecvatnsagtrysapanlyvrelrevrrvpprfsipptnheimpggsvnitcvavgspmpyv kwmlgaedltpeddmpigrnvlelndvrqsanytcvamstlgvieavaqitvkalpkppgtpvvtesta tsitltwdsgnpepvsyyiiqhkpknseepykeidgiattrysvaglspysdyefrvvavnnigrgpas epvltqtseqapssaprdvqarmlssttilvqwkepeepngqiqgyrvyytmdptqhvnnwmkhnvads qittignlvpqktysvkvlaftsigdgplssdiqvitqtgvpgqplnfkaepesetsillswtpprsdt iasyelvyrdgdqgeeqritiepgtsyrlqglkpnslyyfrlsarspqglgastaeisartmqskpsap pqdisctspsstsilvswqpppvekqngiiteyslkyaavdgedyrpheilgipsdttkylleqlekwt eyritvtahtdvgpgpeslsvlirtdedvpsgpprkveveavnatavkvswrspvpnkqhgqirgyqvh yvkmengepkgqpmlkdvmladaqwefddatehdmiisglqpetsysltvtayttkgdgarskpklvst tgavpgrprlvinhtqmntaliqwhppvdtfgplqgyrlkfgrkdmeplttlefsekedhftatdihkg asyifrlsarnkvgfgeemvkeisvpeevptgfpqnlhsegttstsvqiswqppvlaerngvitkytll yrdinvpllpmehlivpadtsmtltglksdttydvkvrahtskgpgpyspsvqfrtlpvdqvfaknfhv kavmktsvllsweipenynsampfkilyddgkmveevdgratqklivnlkpeksysfvltnrgnsaggl qhrvtaktapdvlrtkpafigktnldgmitvqlpdvpanenikgyyiiivplkksrgkfikpwespdem eldellkeisrkrrsirygrevelkpyiaahfdvlpteftlgddkhyggftnkqlqsgqeyvffvlavm dhaeskmyatspysdpvvsmdldpqpitdeeegliwvvgpvlavvfiiciviaillykrkraesesrks slpnskevpshhptdpvelrrlnfqtpgmashppipileladhierlkandnlkfsqeyesidpgqqft wehsnlevnkpknryanviaydhsrvllsaiegipgsdyvnanyidgyrkqnayiatqgslpetfgdfw rmiweqrsatvvmmtkleersrvkcdqywpsrgtethglvqvtlldtvelatycvrtfalykngssekr evrqfqftawpdhgvpehptpflaflrrvktcnppdagpmvvhcsagvgrtgcfividamlerikhekt vdiyghvtlmraqrnymvqtedqyifihdalleavtcgntevparnlyayiqkltqietgenvtgmele fkrlasskahtsrfisanlpcnkfknrlvnimpyestrvclqpirgvegsdyinasfldgyrqqkayia tqgplaettedfwrmlwehnstivvmltklremgrekchqywpaersaryqyfvvdpmaeynmpqyilr efkvtdardgqsrtvrqfqftdwpeqgvpksgegfidfigqvhktkeqfgqdgpisvhcsagvgrtgvf itlsivlermryegvvdifqtvkmlrtqrpamvqtedqyqfcyraaleylgsfdhyat
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.00 Rfree 0.237
    Matthews' coefficent 3.12 Rfactor 0.197
    Waters 628 Solvent Content 60.58

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2nv5
    1. Structural genomics of protein phosphatases
    SC Almo, JB Bonanno, JM Sauder, S Emtage - Journal of structural and , 2007 - Springer
     
    2. Algorithms for Local Structural Alignment and Structural Motif Identification
    S Rajasekaran, V Kundeti - Algorithms in , 2011 - Wiley Online Library
     
    3. A local structural alignment algorithm with Variable Length Alignment Fragment Pairs
    V Kundeti, S Rajasekaran - BioInformatics and BioEngineering, , 2008 - ieeexplore.ieee.org
     

    Protein Summary

    This structure is human PTPRD. It was cloned from rat brain cDNA, however the sequence of the catalytic domain that yielded the structure is 100% identical to the human ortholog. 

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch