.
The Open Protein Structure Annotation Network
PDB Keyword
.

2nwi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hypothetical protein O28875 from Archaeoglobus fulgidus. To be Published
    Site NYSGXRC
    PDB Id 2nwi Target Id NYSGXRC-10167c
    Molecular Characteristics
    Source Archaeoglobus fulgidus
    Alias Ids TPS7987,PF01947, O28875 Molecular Weight 18947.95 Da.
    Residues 162 Isoelectric Point 7.99
    Sequence mnaihrilmttdgsitaiieavtqkkvevetleqkiiradrelaelleidegdevnyrvvylrangeiy akaisftplkrlensfredlmradipigkimrkhniearreirwsrveeadlalakelgiadrrvisrn yniihrgkvliniteffpmerfri
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.20 Rfree 0.276
    Matthews' coefficent 2.31 Rfactor 0.208
    Waters 489 Solvent Content 46.86

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2nwi
    1. A new approach to assess and predict the functional roles of proteins across all known structures
    ES Julfayev, RJ McLaughlin, YP Tao - Journal of structural and , 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch