.
The Open Protein Structure Annotation Network
PDB Keyword
.

2nwu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title UPF201 archaeal specific family members reveal structural similarity to RNA-binding proteins but low likelihood for RNA-binding function. Plos One 3 e3903-e3903 2008
    Site NYSGXRC
    PDB Id 2nwu Target Id NYSGXRC-10077b
    Molecular Characteristics
    Source Sulfolobus solfataricus
    Alias Ids TPS7951,PF01877, Q97Z89 Molecular Weight 16422.35 Da.
    Residues 145 Isoelectric Point 7.94
    Sequence mvkvmvvaevrpsedvnkvlsaisnffdfekmntrkegiidilvleartlksllkfhrvlrnerildsa rkylmkgiegntiafmihkqaaavgvlsfvdsdkesplgaikfyieyqnpkeivdwlapktahgvplwd npvppdv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.298
    Matthews' coefficent 2.58 Rfactor 0.251
    Waters 52 Solvent Content 52.29

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2nwu
    1. UPF201 archaeal specific family members reveal structural similarity to RNA-binding proteins but low likelihood for RNA-binding function
    KN Rao, SK Burley, S Swaminathan - PloS one, 2008 - dx.plos.org
     
    2. Crystal structure of the DUF54 family protein PH1010 from hyperthermophilic archaea Pyrococcus horikoshii OT3
    K Miyazono, M Shirokane, Y Sawano - Proteins: Structure, , 2009 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch