.
The Open Protein Structure Annotation Network
PDB Keyword
.

2nxo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a hypothetical protein SCO4506 (gene ID: Q9L0T8) from Streptomyces coelicolor to 2.04 Angstrom resolution. To be Published
    Site NYSGXRC
    PDB Id 2nxo Target Id NYSGXRC-10093f
    Molecular Characteristics
    Source Streptomyces coelicolor
    Alias Ids TPS7958,PF02621, Q9L0T8 Molecular Weight 31324.05 Da.
    Residues 282 Isoelectric Point 4.81
    Sequence vdnsrtrprvghiqflnclplywglartgtlldfeltkdtpeklseqlvrgdldigpvtlveflknadd lvafpdiavgcdgpvmscvivsqvpldrldgarvalgstsrtsvrlaqlllserfgvqpdyytcppdls lmmqeadaavligdaalranmidgprygldvhdlgalwkewtglpfvfavwaarrdyaerepvitrkvh eaflasrnlsleevekvaeqaarweafdedtlakyfttldfrfgapqleavtefarrvgpttgfpadvk vellkp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.04 Rfree 0.28
    Matthews' coefficent 2.36 Rfactor 0.249
    Waters 550 Solvent Content 47.81

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2nxo
    1. A structural classification of substrate-binding proteins
    RPA Berntsson, SHJ Smits, L Schmitt, DJ Slotboom - FEBS letters, 2010 - Elsevier
     
    2. Crystal structure of MqnD (TTHA1568), a menaquinone biosynthetic enzyme from Thermus thermophilus HB8
    R Arai, K Murayama, T Uchikubo-Kamo - Journal of structural , 2009 - Elsevier
     
    3. X-ray structures of two proteins belonging to Pfam DUF178 revealed unexpected structural similarity to the DUF191 Pfam family
    R Tyagi, SK Burley, S Swaminathan - BMC structural biology, 2007 - biomedcentral.com
     
    4. A structural classification of substrate-binding proteins
    PAB Ronnie, SHJ Smits, L Schmitt, DJ Slotboom - FEBS , 2010 - gbb.eldoc.ub.rug.nl
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch