.
The Open Protein Structure Annotation Network
PDB Keyword
.

2nyg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of YokD protein from Bacillus subtilis. To be Published
    Site NYSGXRC
    PDB Id 2nyg Target Id NYSGXRC-10116c
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS7971,O32003, PF02522 Molecular Weight 30912.81 Da.
    Residues 272 Isoelectric Point 6.62
    Sequence mkkivesttfprtkqsitedlkalglkkgmtvlvhsslssigwvnggavaviqalidvvteegtivmps qsvelsdpkewgnppvpeewwdiiresmpaynsnytpttrgmgqivelfrsypevkrsnhpnysfvawg khknkilnqhplefglgeqsplgklyiresyvlllgadfdsstcfhlaeyripyqkiinrgapiivegk rvwkeykelefreelfqevgqafeaehnmkvgkvgsancrlfslteavdfaekwfinndsknikk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.60 Rfree 0.296
    Matthews' coefficent 2.41 Rfactor 0.257
    Waters 223 Solvent Content 48.99

    Ligand Information
    Ligands COA (COENZYME) x 5
    Metals

    Jmol

     
    Google Scholar output for 2nyg
    1. Thermodynamics and Kinetics of Association of Antibiotics with the Aminoglycoside Acetyltransferase (3)-IIIb, a Resistance-Causing Enzyme
    AL Norris, C O_zen, EH Serpersu - Biochemistry, 2010 - ACS Publications
     
    2. Structural analysis of a putative aminoglycoside N-acetyltransferase from Bacillus anthracis
    MM Klimecka, M Chruszcz, J Font, T Skarina - Journal of molecular , 2011 - Elsevier
     
    3. Deciphering Substrate Promiscuity by Aminoglycoside Resistance Enzymes via a Biophysical Characterization and Dynamics of the Aminoglycoside Acetyltransferase
    AL Norris - 2011 - trace.tennessee.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch