.
The Open Protein Structure Annotation Network
PDB Keyword
.

2nyv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of a phosphoglycolate phosphatase from Aquifex aeolicus. To be Published
    Site NYSGXRC
    PDB Id 2nyv Target Id NYSGXRC-6223c
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS7753,NP_213923.1 Molecular Weight 23894.38 Da.
    Residues 213 Isoelectric Point 5.17
    Sequence mrvilfdldgtlidsakdialalektlkelgleeyypdnvtkyigggvrallekvlkdkfreeyvevfr khylenpvvytkpypeipytlealkskgfklavvsnkleelskkildilnlsgyfdlivggdtfgekkp sptpvlktleilgeepekalivgdtdadieagkragtktalalwgyvklnsqipdftlsrpsdlvklmd nhivef
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.269
    Matthews' coefficent 2.85 Rfactor 0.204
    Waters 236 Solvent Content 56.79

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch