.
The Open Protein Structure Annotation Network
PDB Keyword
.

2o34

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Hypothetical Protein from Desulfovibrio vulgaris Hildenborough. To be Published
    Site NYSGXRC
    PDB Id 2o34 Target Id NYSGXRC-10252a
    Molecular Characteristics
    Source Desulfovibrio vulgaris
    Alias Ids TPS8009,PF04040, Q72D34 Molecular Weight 26446.80 Da.
    Residues 249 Isoelectric Point 5.18
    Sequence mpmqhvhtspvrdyrnrcarregetvfqvvveetdlrvtalaelatpmaayvgelraqlkvwmefqpaf rhslvpvevpegapevvrrmahgarlvgvgpfaavagtiaqmvaerfvdvspelivenggdlylyserd rvvgilpdpasgdmvgilvragtapvslcgssarighslslgdgdlavvrardasladaaatafgnmlr raddvaavteraaqlasigiegvyaqcggrigiwgdmelava
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.95 Rfree 0.273
    Matthews' coefficent 3.62 Rfactor 0.21
    Waters 374 Solvent Content 66.02

    Ligand Information
    Ligands
    Metals NA (SODIUM) x 3

    Jmol

     
    Google Scholar output for 2o34
    1. FAD Binding by ApbE Protein from Salmonella enterica: a New Class of FAD-Binding Proteins
    JM Boyd, JA Endrizzi, TL Hamilton - Journal of , 2011 - Am Soc Microbiol
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch