.
The Open Protein Structure Annotation Network
PDB Keyword
.

2o3a

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a protein AF_0751 from Archaeoglobus fulgidus. To be Published
    Site NYSGXRC
    PDB Id 2o3a Target Id NYSGXRC-10324a
    Molecular Characteristics
    Source Archaeoglobus fulgidus
    Alias Ids TPS8015,PF01994, O29507 Molecular Weight 19025.12 Da.
    Residues 168 Isoelectric Point 7.83
    Sequence mevyvlrlghrperdkristhvaltarafgakgiyfdtedksvfesvrdvverwggdffikavswkkll refdglkvhltmygiplpqkleeikradkvlvvvgaekvppevyelcdlnisigtqphsevaalavfld rvlgkvfdisfddakikvipsergkrvvse
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.292
    Matthews' coefficent 2.00 Rfactor 0.23
    Waters 91 Solvent Content 38.41

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2o3a
    1. The crystal structure of Nep1 reveals an extended SPOUT-class methyltransferase fold and a pre-organized SAM-binding site
    AB Taylor, B Meyer, BZ Leal, P Ktter - Nucleic Acids , 2008 - Oxford Univ Press
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch