.
The Open Protein Structure Annotation Network
PDB Keyword
.

2oce

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hypothetical protein PA5201 from Pseudomonas aeruginosa. To be Published
    Site NYSGXRC
    PDB Id 2oce Target Id NYSGXRC-6019b
    Molecular Characteristics
    Source Pseudomonas aeruginosa
    Alias Ids TPS7930,PF03652 Molecular Weight 84959.29 Da.
    Residues 779 Isoelectric Point 6.00
    Sequence mdsintriaeelsalpsgrvqpqqvaaavalldegstvpfiaryrkevtgslddtqlrmleerlrylre leerrgailasieeqgkltpelardikladtktrledlylpykqkrrtkgqialeaglgaladalfddp tlvpeseaarfvdaekgfadvkavlegakyilmerfaedatlldklrvfmkneatltarvvpgkeqega kfsdyfehdeplksapshralaifrgrnegvlsaslkvgeeapgtlhpcevmiaerfglsnqgraadkw laevvrwtwkvklythletdlfgelrdgaedeaisvfarnlhdlllaapagpratlgldpglrtgvkva vvdatgklldtatvyphapknqwdqtlavlaalcakhqveliaigngtasretdklagelikkypgmkl tkimvseagasvysaselaakefpeldvslrgavsiarrlqdplaelvkiepksigvgqyqhdvsqlkl arsldavvedcvnavgvdvntasaallarisglnstlaqnivahrdangafrtrdelkkvsrlgektfe qaagflrvmngdnpldasavhpetyplvqriaadterdirsligdsaflkrldpkkftdetfglptvtd ilkeldkpgrdprpefktaefqegveslkdlkpgmvlegvvtnvtnfgafvdigvhqdglvhisalsek fvkdpyevvkagdivkvkvmevdiprnrvglsmrmsdtpgekvegqrggrptgsgqprqergaprgqsa ppannamaalfanakqlkkk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 3.10 Rfree 0.279
    Matthews' coefficent 2.87 Rfactor 0.208
    Waters 266 Solvent Content 57.12

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2oce
    1. Crystal Structure and RNA Binding of the Tex Protein from Pseudomonas aeruginosa
    SJ Johnson, D Close, H Robinson, I Vallet-Gely - Journal of molecular , 2008 - Elsevier
     
    2. Crystal Structure and RNA Binding of the Tex Protein
    I Vallet-Gely, SL Dove, CP Hill - J. Mol. Biol, 2008 - wasatch.biochem.utah.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch