.
The Open Protein Structure Annotation Network
PDB Keyword
.

2og9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of mandelate racemase/muconate lactonizing enzyme from Polaromonas sp. JS666. To be Published
    Site NYSGXRC
    PDB Id 2og9 Target Id NYSGXRC-9382a
    Related PDB Ids 3cb3 
    Molecular Characteristics
    Source Polaromonas sp. js666
    Alias Ids TPS7832,PF02746 Molecular Weight 41721.45 Da.
    Residues 383 Isoelectric Point 6.36
    Sequence mktttsstpsdritwvrisscylplatpisdakvltgrqkpmteiailfaeietagghqglgfsyskra ggpgqfahareiapaligedpsdiaklwdklcwagasagrsglstqaigafdvalwdlkakraglslak llgsyrdsvrcyntsggflhtpidqlmvnasasiergiggiklkvgqpdgaldiarvtavrkhlgdavp lmvdanqqwdrptaqrmcrifepfnlvwieepldaydheghaalalqfdtpiatgemltsaaehgdlir hraadylmpdaprvggitpflkiaslaehaglmlaphfamelhvhlaaayprepwvehfewleplfner ieirdgrmlvptrpglgltlsgqvkawtreeaqvgtrp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.23
    Matthews' coefficent 2.24 Rfactor 0.203
    Waters 359 Solvent Content 45.01

    Ligand Information
    Ligands
    Metals CA (CALCIUM) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch