.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ogf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hypothetical protein MJ0408 from Methanococcus jannaschii. To be Published
    Site NYSGXRC
    PDB Id 2ogf Target Id NYSGXRC-10163a
    Molecular Characteristics
    Source Methanococcus jannaschii
    Alias Ids TPS7983,Q57851, PF04038 Molecular Weight 14180.86 Da.
    Residues 121 Isoelectric Point 7.76
    Sequence mrveetevfkkyfknltdreravfeggitlgalfhqfvgtpvskynkesleraieeamknqpcvydikv kirnvgekyvsldgkmldvdlkikinktvahlkleyipeidyplmyvkkfee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.89 Rfree 0.224
    Matthews' coefficent 2.11 Rfactor 0.173
    Waters 339 Solvent Content 41.83

    Ligand Information
    Ligands OXG (8-OXOGUANINE) x 4;SO4 (SULFATE) x 2;GOL (GLYCEROL) x 2
    Metals

    Jmol

     
    Google Scholar output for 2ogf
    1. The SeqFEATURE library of 3D functional site models: comparison to existing methods and applications to protein function annotation
    S Wu, MP Liang, RB Altman - Genome biology, 2008 - biomedcentral.com
     
    2. Comparative genomics guided discovery of two missing archaeal enzyme families involved in the biosynthesis of the pterin moiety of methanopterin and
    V De Crecy-Lagard, G Phillips - ACS Chemical , 2012 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch