.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ogj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a dihydroorotase. To be Published
    Site NYSGXRC
    PDB Id 2ogj Target Id NYSGXRC-9244b
    Molecular Characteristics
    Source Agrobacterium tumefaciens
    Alias Ids TPS7777,17936977, PF01979 Molecular Weight 43966.69 Da.
    Residues 407 Isoelectric Point 5.83
    Sequence mtsgeqaktplqapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridakgafisp gwvdlhvhiwhggtdisirpsecgaergvttlvdagsageanfhgfreyiiepsrerikaflnlgsigl vacnrvpelrdikdidldrilecyaensehivglkvrashvitgswgvtpvklgkkiakilkvpmmvhv geppalydevleilgpgdvvthcfngksgssimededlfnlaercagegirldighggasfsfkvaeaa iargllpfsistdlhghsmnfpvwdlattmskllsvdmpfenvveavtrnpasvirldmenrldvgqra dftvfdlvdadleatdsngdvsrlkrlfepryavigaeaiaasryiprarklvrhshgyswr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.62 Rfree 0.302
    Matthews' coefficent 2.37 Rfactor 0.256
    Waters 113 Solvent Content 48.17

    Ligand Information
    Ligands IMD (IMIDAZOLE) x 2
    Metals ZN (ZINC) x 12

    Jmol

     
    Google Scholar output for 2ogj
    1. Target selection and annotation for the structural genomics of the amidohydrolase and enolase superfamilies
    U Pieper, R Chiang, JJ Seffernick, SD Brown - Journal of structural and , 2009 - Springer
     
    2. Dihydroorotase of human malarial parasite Plasmodium falciparum differs from host enzyme
    SR Krungkrai, N Wutipraditkul, J Krungkrai - Biochemical and biophysical , 2008 - Elsevier
     
    3. Structures of Ligand-free and Inhibitor Complexes of Dihydroorotase from Escherichia coli: Implications for Loop Movement in Inhibitor Design
    M Lee, CW Chan, SC Graham - Journal of molecular , 2007 - Elsevier
     
    4. Reversible post-translational carboxylation modulates the enzymatic activity of N-acetyl-L-ornithine transcarbamylase
    Y Li, X Yu, J Ho, D Fushman, N Allewell - Biochemistry, 2010 - ACS Publications
     
    5. Modeling loop backbone flexibility in receptor_ligand docking simulations
    J Flick, F Tristram, W Wenzel - Journal of Computational , 2012 - Wiley Online Library
     
    6. Dihydroorotase Inhibitors
    M Lee, MJ Maher, RI Christopherson - Drug Design of Zinc_ , 2009 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch