.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ogk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title UPF201 archaeal specific family members reveal structural similarity to RNA-binding proteins but low likelihood for RNA-binding function. Plos One 3 e3903-e3903 2008
    Site NYSGXRC
    PDB Id 2ogk Target Id NYSGXRC-10077d
    Molecular Characteristics
    Source Archaeoglobus fulgidus
    Alias Ids TPS7953,O27966, PF01877 Molecular Weight 16538.16 Da.
    Residues 145 Isoelectric Point 5.51
    Sequence mkgkiewvrvsavvhstedrekvgeaistlfpfefeiavskakghygnpmeyleveltksseikkfwkn llellgeqaeeilstledrideqnvlhiridkqkaylgevsltsggdpiavklrlvtypskrekviefa relctis
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 3.00 Rfree 0.309
    Matthews' coefficent 3.94 Rfactor 0.262
    Waters 44 Solvent Content 68.81

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ogk
    1. UPF201 archaeal specific family members reveal structural similarity to RNA-binding proteins but low likelihood for RNA-binding function
    KN Rao, SK Burley, S Swaminathan - PloS one, 2008 - dx.plos.org
     
    2. Expression, purification and structural analysis of the Pyrococcus abyssi RNA binding protein PAB1135
    J Luz, J Barbosa, C Ramos, C Oliveira - BMC research notes, 2010 - biomedcentral.com
     
    3. Crystal structure of the DUF54 family protein PH1010 from hyperthermophilic archaea Pyrococcus horikoshii OT3
    K Miyazono, M Shirokane, Y Sawano - Proteins: Structure, , 2009 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch