The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the YueI protein from Bacillus subtilis. To be Published
    Site NYSGXRC
    PDB Id 2ohw Target Id NYSGXRC-10171a
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS7989,O32092, PF07997 Molecular Weight 15172.61 Da.
    Residues 132 Isoelectric Point 6.47
    Sequence lsedkmdlylqqgmygpletkpderhlflgslrervvlaltkgqvlrskpykeaehelknshnvtllin gelqyqsyssyiqmasrygvpfkivsdlqfhtplgiviaadiavnreliyiqddiynrsvlks
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.40 Rfree 0.233
    Matthews' coefficent 1.95 Rfactor 0.202
    Waters 121 Solvent Content 36.77

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch