.
The Open Protein Structure Annotation Network
PDB Keyword
.

2okt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of O-Succinylbenzoic Acid Synthetase from Staphylococcus Aureus. To be Published
    Site NYSGXRC
    PDB Id 2okt Target Id NYSGXRC-9307b
    Related PDB Ids 3h70 
    Molecular Characteristics
    Source Staphylococcus aureus
    Alias Ids TPS7817,15924786, PF01188 Molecular Weight 38028.76 Da.
    Residues 333 Isoelectric Point 5.56
    Sequence mkltalhfykysepfksqivtpkvtlthrdclfieliddkgnayfgecnafqtdwydhetiasvkhvie qwfednrnksfetyeaalklvdslentpaarativmalyqmfhvlpsfsvaygatasglsnkqleslka tkptriklkwtpqimhqirvlreldfhfqlvidanesldrqdftqlqllareqvlyieepfkdismlde vvdgtippialdekatslldiinlielynvkvvvlkpfrlggidkvqtaidtlkshgvkvviggmyeyg lsryftamlarkgdypgdvtpagyyfdqdvvtksgilkegrlefrpplvditqlqpy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.30 Rfree 0.181
    Matthews' coefficent 2.19 Rfactor 0.138
    Waters 590 Solvent Content 44.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2okt
    1. Study of enzyme evolution within the MLE subgroup focusing on characterizing member enzymes for the purpose of discovering relationships among sequence,
    A Sakai - 2010 - gradworks.umi.com
     
    2. Residues required for activity in Escherichia coli o-succinylbenzoate synthase are not conserved in all OSBS enzymes
    WW Zhu, C Wang, J Jipp, L Ferguson, SN Lucas - Biochemistry, 2012 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch