.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ola

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of O-Succinylbenzoic Acid Synthetase from Staphylococcus Aureus. To be Published
    Site NYSGXRC
    PDB Id 2ola Target Id NYSGXRC-9307a
    Molecular Characteristics
    Source Staphylococcus aureus
    Alias Ids TPS7816,PF01188, 1255260 Molecular Weight 37965.61 Da.
    Residues 333 Isoelectric Point 5.53
    Sequence mkltalhfykysepfksqivtpkvtlthrdclfieliddkgnayfgecnafqtdwydhetiasvkhvie qwfednrnksfetyeaalklvdslentpaarativmalyqmfhvlpsfsvaygatasglsnkqleslka tkptriklkwtpqimhqirvlreldfhfqlvidanesldrqdftqlqllareqvlyieepfkdismlde vadgtippialdekatslldiinlielynvkvvvlkpfrlggidkvqtaidtlkshgakvviggmyeyg lsryftamlarkgdypgdvtpagyyfeqdvvahsgilkegrlefrpplvditqlqpy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.45 Rfree 0.26081
    Matthews' coefficent 3.16 Rfactor 0.21115
    Waters 60 Solvent Content 61.10

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ola
    1. Study of enzyme evolution within the MLE subgroup focusing on characterizing member enzymes for the purpose of discovering relationships among sequence,
    A Sakai - 2010 - gradworks.umi.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch