.
The Open Protein Structure Annotation Network
PDB Keyword
.

2oo2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the hypothetical AF_1782 protein from Archaeoglobus fulgidus. To be Published
    Site NYSGXRC
    PDB Id 2oo2 Target Id NYSGXRC-10200c
    Molecular Characteristics
    Source Archaeoglobus fulgidus
    Alias Ids TPS7997,O28492, PF04010 Molecular Weight 9115.88 Da.
    Residues 76 Isoelectric Point 4.63
    Sequence veeelrretlkwlerieervkeiegdegfmrnieayisdsryflekgdlvrafecvvwawawleiglev gklheta
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.289
    Matthews' coefficent 2.16 Rfactor 0.24
    Waters 23 Solvent Content 42.97

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2oo2
    1. SPRITE and ASSAM: web servers for side chain 3D-motif searching in protein structures
    N Nadzirin, EJ Gardiner, P Willett, PJ Artymiuk - Nucleic Acids , 2012 - imanhost.in
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch