.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ood

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of guanine deaminase from Bradyrhizobium japonicum. To be Published
    Site NYSGXRC
    PDB Id 2ood Target Id NYSGXRC-9231a
    Molecular Characteristics
    Source Bradyrhizobium japonicum
    Alias Ids TPS7775,PF01979, 27378957 Molecular Weight 51552.72 Da.
    Residues 465 Isoelectric Point 5.99
    Sequence mttvgirgtffdfvddpwkhigneqaaarfhqdglmvvtdgvikafgpyekiaaahpgveithikdrii vpgfidghihlpqtrvlgaygeqllpwlqksiypeeikykdrnyaregvkrfldallaagtttcqafts sspvateelfeeasrrnmrviagltgidrnapaefidtpenfyrdskrliaqyhdkgrnlyaitprfaf gaspellkacqrlkhehpdcwvnthisenpaecsgvlvehpdcqdylgvyekfdlvgpkfsgghgvyls nnefrrmskkgaavvfcpcsnlflgsglfrlgratdpehrvkmsfgtdvgggnrfsmisvlddaykvgm cnntlldgsidpsrkdlaeaernklspyrgfwsvtlggaeglyiddklgnfepgkeadfvaldpnggql aqpwhqsliadgagprtvdeaasmlfavmmvgddrcvdetwvmgkrlykks
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.62 Rfree 0.2216
    Matthews' coefficent Rfactor 0.1865
    Waters 310 Solvent Content

    Ligand Information
    Ligands GUN (GUANINE) x 1
    Metals ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 2ood
    1. Target selection and annotation for the structural genomics of the amidohydrolase and enolase superfamilies
    U Pieper, R Chiang, JJ Seffernick, SD Brown - Journal of structural and , 2009 - Springer
     
    2. Phylogenetic analysis and molecular evolution of guanine deaminases: from guanine to dendrites
    JR Fernndez, B Byrne, BL Firestein - Journal of molecular evolution, 2009 - Springer
     
    3. Bacterial ammeline metabolism via guanine deaminase
    JL Seffernick, AG Dodge, MJ Sadowsky - Journal of , 2010 - Am Soc Microbiol
     
    4. Structural characterization and transcriptional regulation of the cytosolic PSD-95 interacting protein (CYPIN) and its role in neuronal dendrite branching
    JR Fernandez - 2008 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch