.
The Open Protein Structure Annotation Network
PDB Keyword
.

2oof

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of 4-imidazolone-5-propanoate amidohydrolase from environmental sample. To be Published
    Site NYSGXRC
    PDB Id 2oof Target Id NYSGXRC-9252h
    Related PDB Ids 2q09 
    Molecular Characteristics
    Source Unknown
    Alias Ids TPS7785,PF01979 Molecular Weight 43927.21 Da.
    Residues 406 Isoelectric Point 5.54
    Sequence mncervwlnvtpatlrsdladygllephalgvhegrihalvpmqdlkgpypahwqdmkgklvtpglidc hthlifagsraeefelrqkgvpyaeiarkgggiistvratraasedqlfelalprvksliregvttvei ksgygltledelkmlrvarrlgealpirvkttllaahavppeyrddpdswveticqeiipaaaeaglad avdvfcehigfslaqteqvylaadqyglavkghmdqlsnlggstlaanfgalsvdhleyldpegiqala hrgvvatllptafyflketklppvvalrkagvpmavssdinpgtapivslrmamnmactlfgltpveam agvtrhaaralgeqeqlgqlrvgmladflvwncghpaelsyligvdqlvsrvvngeetlhg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.225
    Matthews' coefficent 3.36 Rfactor 0.208
    Waters 232 Solvent Content 63.41

    Ligand Information
    Ligands
    Metals FE (FE) x 1

    Jmol

     
    Google Scholar output for 2oof
    1. Target selection and annotation for the structural genomics of the amidohydrolase and enolase superfamilies
    U Pieper, R Chiang, JJ Seffernick, SD Brown - Journal of structural and , 2009 - Springer
     
    2. A Common Catalytic Mechanism for Proteins of the HutI Family
    R Tyagi, S Eswaramoorthy, SK Burley, FM Raushel - Biochemistry, 2008 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch