.
The Open Protein Structure Annotation Network
PDB Keyword
.

2oog

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Glycerophosphoryl Diester Phosphodiesterase from Staphylococcus Aureus. To be Published
    Site NYSGXRC
    PDB Id 2oog Target Id NYSGXRC-6255a
    Related PDB Ids 2p76 
    Molecular Characteristics
    Source Staphylococcus aureus
    Alias Ids TPS7756,PF03009, NP_371483.1 Molecular Weight 35309.08 Da.
    Residues 309 Isoelectric Point 8.67
    Sequence mtnssksftkfmaasavftmgflsvptagaeqtnqiankpqaiqwhtnltnerfttiahrgasgyapeh tfqaydkshnelkasyieidlqrtkdghlvamhdetvnrttnghgkvedytldelkqldagswfnkkyp kyarasyknakvptldeilerygpnanyyietkspdvypgmeeqllaslkkhhllnnnklknghvmiqs fsdeslkkihrqnkhvplvklvdkgelqqfndqrlkeirsyaiglgpdytdlteqnthhlkdlgfivhp ytvnekadmlrlnkygvdgvftnfadkykevik
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.20 Rfree 0.28044
    Matthews' coefficent 3.19 Rfactor 0.23484
    Waters 891 Solvent Content 61.30

    Ligand Information
    Ligands SO4 (SULFATE) x 6;GOL (GLYCEROL) x 39
    Metals ZN (ZINC) x 6

    Jmol

     
    Google Scholar output for 2oog
    1. Crystal structure of glycerophosphodiester phosphodiesterase (GDPD) from Thermoanaerobacter tengcongensis, a metal ion_dependent enzyme: Insight into the
    L Shi, JF Liu, XM An, DC Liang - Proteins: Structure, Function, , 2008 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch