.
The Open Protein Structure Annotation Network
PDB Keyword
.

2opj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of O-succinylbenzoate synthase. To be Published
    Site NYSGXRC
    PDB Id 2opj Target Id NYSGXRC-9312b
    Related PDB Ids 2qvh 
    Molecular Characteristics
    Source Thermobifida fusca
    Alias Ids TPS7819,PF01188 Molecular Weight 34098.03 Da.
    Residues 317 Isoelectric Point 5.14
    Sequence mtgrafaiplrtrfrgitvregmlvrgaagwgefspfaeygprecarwwaacyeaaelgwpapvrdtvp vnatvpavgpeeaarivassgcttakvkvaergqseandvarveavrdalgprgrvridvngawdvdta vrmirlldrfeleyveqpcatvdelaevrrrvsvpiaadesirraedplrvrdaeaadvvvlkvqplgg vraalrlaeecglpvvvssavetsvglaagvalaaalpelpyacglatlrllhadvcddpllpvhgvlp vrrvdvseqrlaeveidpaawqarlaaaraaweqverepgp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.226
    Matthews' coefficent 1.82 Rfactor 0.202
    Waters 201 Solvent Content 32.53

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2opj
    1. Study of enzyme evolution within the MLE subgroup focusing on characterizing member enzymes for the purpose of discovering relationships among sequence,
    A Sakai - 2010 - gradworks.umi.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch