.
The Open Protein Structure Annotation Network
PDB Keyword
.

2oqh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an isomerase from Streptomyces coelicolor. To be Published
    Site NYSGXRC
    PDB Id 2oqh Target Id NYSGXRC-9291a
    Molecular Characteristics
    Source Streptomyces coelicolor
    Alias Ids TPS7809,21225834, PF01188 Molecular Weight 39967.50 Da.
    Residues 375 Isoelectric Point 5.04
    Sequence mkitdvdvwvvnlplvnpftssfetktgetrtvvrvrtdsgvegwgetmwgapvaaivrrmapdligts pfaleafhrkqhmvpffygylgyaaiaavdvacwdamgkatgqsvtdllggavrdevpitalitradap gatpadlpkamaehavrvveeggfdavklkgttdcagdvailravrealpgvnlrvdpnaawsvpdsvr agialeeldleyledpcvgiegmaqvkakvriplctnmcvvrfedfapamrlnavdvihgdvykwggia atkalaahcetfglgmnlhsggelgiataahlavvsstpvlsraidsmyylhaddiieplhlengrlrv psgpglgvsvdedklrhyagvnerdgdltg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.98 Rfree 0.231
    Matthews' coefficent 2.75 Rfactor 0.205
    Waters 945 Solvent Content 55.21

    Ligand Information
    Ligands SO4 (SULFATE) x 4
    Metals

    Jmol

     
    Google Scholar output for 2oqh
    1. The LabelHash algorithm for substructure matching
    M Moll, DH Bryant, LE Kavraki - BMC bioinformatics, 2010 - biomedcentral.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch