.
The Open Protein Structure Annotation Network
PDB Keyword
.

2oux

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the soluble part of a magnesium transporter. To be Published
    Site NYSGXRC
    PDB Id 2oux Target Id NYSGXRC-10001b
    Molecular Characteristics
    Source Enterococcus faecalis
    Alias Ids TPS7931,PF03448, Q830V1 Molecular Weight 50317.60 Da.
    Residues 453 Isoelectric Point 4.16
    Sequence mnegqemeeqfallletlknqqmnefrelflalhiyeqgqfyqsldekdrqhlynylspkeladmfdvi eednenmkdylaemrpsyaadmlaemytdnavdllnmldksqkakylsllsseeageikellhyedeta gaimttefvsivanqtvrsamyvlknqadmaetiyyvyvvdqenhlvgvislrdlivndddtliadiln ervisvhvgddqedvaqtirdydflavpvtdyddhllgivtvddiidviddeaasdysglagvdveevs enplkaaskrlpwlitllflgmstaslisnyeslvseasilavfislitgtagnagtqslavavrrlam kdekdsnfgrlilsevltglvtgavtgltimivvgvwqhnlplgfvigmamlcaitvanlagslipmlm dklgfdpavasgpfittlsdltsvliyfniasmfmryfv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.16 Rfree 0.306
    Matthews' coefficent 2.46 Rfactor 0.26
    Waters 150 Solvent Content 50.03

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 10

    Jmol

     
    Google Scholar output for 2oux
    1. Crystallization and preliminary X-ray diffraction analysis of the full-length Mg2+ transporter MgtE
    M Hattori, Y Tanaka, S Fukai, R Ishitani - Section F: Structural , 2007 - scripts.iucr.org
     
    2. Crystallization and preliminary X-ray diffraction analysis of the cytosolic domain of the Mg2+ transporter MgtE
    Y Tanaka, M Hattori, S Fukai, R Ishitania - Section F: Structural , 2007 - scripts.iucr.org
     
    3. Structural studies on cytosolic domain of magnesium transporter MgtE from Enterococcus faecalis
    S Ragumani, JM Sauder, SK Burley - Proteins: Structure, , 2010 - Wiley Online Library
     
    4. Functional studies on bacterial nucleotide-regulated inorganic pyrophosphatases
    J Jmsn - 2011 - doria.fi
     

    Protein Summary

    2OUX is the structure of the soluble domain of the MgtE magnesium transporter from Enterococcus faecalis. The structure of the equivalent domain as well as the full length membrane protein from Thermus thermophilus has been published by Hattori et al (2007) Nature 448:1072.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch