.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ox4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Putative Dehydratase from Zymomonas Mobilis Zm4. To be Published
    Site NYSGXRC
    PDB Id 2ox4 Target Id NYSGXRC-9270c
    Molecular Characteristics
    Source Zymomonas mobilis
    Alias Ids TPS7801,PF02746 Molecular Weight 43510.33 Da.
    Residues 393 Isoelectric Point 5.55
    Sequence mkitkieifhvhtrpqsgqrpilvkvstdegiyglgeagiaygvggsaaagilkdyaalligedpfnte aiweklfkktfwgqgggtvifsgisafdiafwdikgkalnlpvykllggknredlrvyasqlqfgwgke rkskgrkeeyaeealkavaegydavkvdvlahdrngsregvflegplpsetikigverveairnavgpd vdiivenhghtdlvsaiqfakaieefniffyeeintplnprllkeakkkidiplasgeriysrwgflpf ledrsidviqpdlgtcggftefkkiadmahifevtvqahvagtgvaeaaslhaeiaipnfcihehhqkt llpeyeelcvhnyqpvkgrykvpelpgigqditeklyqisdyvsieas
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 1.80 Rfree 0.18553
    Matthews' coefficent 2.17 Rfactor 0.14386
    Waters 3160 Solvent Content 43.46

    Ligand Information
    Ligands GOL (GLYCEROL) x 14
    Metals MG (MAGNESIUM) x 8;CL (CHLORIDE) x 4

    Jmol

     
    Google Scholar output for 2ox4
    1. Target selection and annotation for the structural genomics of the amidohydrolase and enolase superfamilies
    U Pieper, R Chiang, JJ Seffernick, SD Brown - Journal of structural and , 2009 - Springer
     
    2. VASP-S: A Volumetric Analysis and Statistical Model for Predicting Steric Influences on Protein-Ligand Binding Specificity
    BY Chen, S Bandyopadhyay - Bioinformatics and Biomedicine ( , 2011 - ieeexplore.ieee.org
     
    3. A statistical model of overlapping volume in ligand binding cavities
    BY Chen, S Bandyopadhyay - Bioinformatics and Biomedicine , 2011 - ieeexplore.ieee.org
     
    4. Characterization of a novel Agrobacterium tumefaciens Galactarolactone Cycloisomerase Enzyme for Direct Conversion of d-Galactarolactone to 3-Deoxy-2-keto-l-
    M Andberg, H Maaheimo, H Boer, M Penttil - Journal of Biological , 2012 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch