.
The Open Protein Structure Annotation Network
PDB Keyword
.

2oyc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural genomics of protein phosphatases. J.Struct.Funct.Genom. 8 121-140 2007
    Site NYSGXRC
    PDB Id 2oyc Target Id NYSGXRC-8744a
    Related PDB Ids 2p69 2p27 
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS7922,PF00702, NP_064711 Molecular Weight 31696.26 Da.
    Residues 296 Isoelectric Point 6.12
    Sequence marcerlrgaalrdvlgraqgvlfdcdgvlwngeravpgapellerlaragkaalfvsnnsrrarpela lrfarlgfgglraeqlfssalcaarllrqrlpgppdapgavfvlggeglraelraaglrlagdpsagdg aaprvravlvgydehfsfaklreacahlrdpecllvatdrdpwhplsdgsrtpgtgslaaavetasgrq alvvgkpspymfecitenfsidpartlmvgdrletdilfghrcgmttvltltgvsrleeaqaylaagqh dlvphyyvesiadltegled
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.72 Rfree 0.223
    Matthews' coefficent 2.37 Rfactor 0.192
    Waters 168 Solvent Content 48.15

    Ligand Information
    Ligands WO4 (TUNGSTATE(VI)ION) x 1
    Metals NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 2oyc
    1. Structural genomics of protein phosphatases
    SC Almo, JB Bonanno, JM Sauder, S Emtage - Journal of structural and , 2007 - Springer
     
    2. Human HAD phosphatases: structure, mechanism, and roles in health and disease
    A Seifried, J Schultz, A Gohla - FEBS Journal, 2012 - Wiley Online Library
     

    Protein Summary

    PDXP, also known as chronophin, plays a dual role in vitamin B6 metabolism and serves as a major regulator of the actin cytoskeleton. It was first identified as a pyridoxal phosphatase (dephosphorylating PLP), but has more recently been shown to act as a cofilin phosphatase.

    The structure confirms that it is a member of the haloacid dehalogenase (HAD) family. We also determined structures of the Mg-bound form (PDB: 2p27) and the catalytically insert calcium-bound form (PDB: 2p69). The Ca results in a change of metal ligation from six to seven coordinate via bidentate coordination of the catalytic aspartic acid (Asp25), which results in the loss of activity. PLP is largely buried, with the phosphate completely shielded from solvent.

    After this (2OYC) structure was deposited in the PDB by NYSGXRC, three similar chronophin structures from Kang et al were released from the PDB (2CFR, 2CFS, 2CFT).


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch